Product Usage: This product is intended for research purposes only.
All product information available on this website is for educational purposes only. Any form of bodily introduction into humans or animals is strictly prohibited by law. This product should only be handled by licensed and qualified professionals. It is not a drug, food, or cosmetic, and must not be misbranded, misused, or mislabeled as such.
6mg in a Vial
During our packaging transition, you may receive products with either our previous or updated label. Rest assured, the formulation, purity and quality remain exactly the same as per our standards.
-25% on everything – until October 31
25% off regular prices, replacing other product sales. Only the crypto payment discount can be combined.
6mg in a Vial
| CAS Number | 154947-66-7 |
|---|---|
| Appearance | Lyophilized Powder |
| Chemical Names | CAMP, IPR001894, CAP-18, CAP18, CRAMP, HSD26, gene FALL39, gene LL37, FALL39, LL37, FALL-39, cathelicidin antimicrobial peptide, Cathelicidins, Cathelicidin, LL-37, 154947-66-7, Ropocamptide, Bac4, All38 peptide, Cathelicidin LL 37, LL-37 (Human), hCAP 18, UNII-3DD771JO2H, LL-37 trifluoroacetate salt, LL-37/hCAP18, 3DD771JO2H, CHEMBL530345, LL 37, Cathelicidin antimicrobial peptide 18, AKOS024458536 |
| Molecular Formula | C205H340N60O53 |
| Sequence | [LL-37, 37 aa] |
| Molecular Weight | 4493 g/mol |
Never received my order. Contacted support and explained the situation and seemed to be helpful initially until I never received my tracking numbers! Followed it up with them and they have been unresponsive. Finally received a response with tracking numbers and hopefully it will be a seamless transaction moving forwards.
Wow Oder came as planned, I was able track it the entire way and made me feel comfortable about my order!
i am extremely happy with the delivery rate and the product!
The research results have been great so far. Super happy with the ordering process and purity is outstanding. Thanks for the outstanding support!
Highly consistent test results. First-class experience with the ordering process and purity is outstanding. I will definitely be back.
Outstanding experience with the ordering process and purity exceeded my expectations. Our research results are completely exceeding expectations. Great value.
We got fantastic research results. Cannot recommend enough the fast turnaround times, the compound is pure and high quality. Highly recommend this vendor.
